PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DS_47E2D90AC1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 216aa    MW: 24103.9 Da    PI: 8.6263
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DS_47E2D90AC1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.43.8e-141663148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g+WT+ Ed +lv  v++lG ++W+  a+  g++Rt+k+c++rw +yl
  Traes_1DS_47E2D90AC1.1 16 KGPWTENEDAQLVWFVRLLGERRWDFLAQVSGLRRTGKSCRLRWVNYL 63
                            79********************************************97 PP

2Myb_DNA-binding52.51.1e-1669114148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                             rgr T++E+ l++ +++++G++ W++Iar+++ gRt++++k++w++++
  Traes_1DS_47E2D90AC1.1  69 RGRITADEERLILSLHAEWGSR-WSRIARKLP-GRTDNEIKNYWRTHM 114
                             899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.5211163IPR017930Myb domain
SuperFamilySSF466893.14E-2714110IPR009057Homeodomain-like
SMARTSM007171.2E-101565IPR001005SANT/Myb domain
PfamPF002491.6E-121663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-191770IPR009057Homeodomain-like
CDDcd001672.39E-71863No hitNo description
PROSITE profilePS5129424.82364118IPR017930Myb domain
SMARTSM007171.7E-1568116IPR001005SANT/Myb domain
PfamPF002491.5E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-2471117IPR009057Homeodomain-like
CDDcd001672.34E-1073114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MCNNSGGRGG AMAARKGPWT ENEDAQLVWF VRLLGERRWD FLAQVSGLRR TGKSCRLRWV  60
NYLHPGLKRG RITADEERLI LSLHAEWGSR WSRIARKLPG RTDNEIKNYW RTHMRKKAQE  120
EKMLAKKKAS SSPSSSSSST TSLTCSASPT ATSSSAATTE APQESTTTSM DDEAEQEATT  180
SASEEKKAEV VQYCSAVDMD QLWNDIAASE SYPEMM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-26161184105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-25161184105C-Myb DNA-Binding Domain
1msf_C1e-25161184105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519040.0JF951904.1 Triticum aestivum clone TaMYB20 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660308.11e-72PREDICTED: transcription factor MYB59-like
SwissprotQ4JL765e-65MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLW5AL091e-159W5AL09_WHEAT; Uncharacterized protein
STRINGBGIOSGA019054-PA1e-74(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.32e-60myb domain protein 59
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]